COL16A1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18837
Additional Names:: 447AA|COL16A1|FP1572
Application:: ELISA, WB
Molecular Weight:: 145kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: PRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL
Uniprot:: Q07092
Synonyms:: 447AA;alpha 1 type XVI collagen;collagen alpha-1(XVI) chain;collagen XVI, alpha-1 polypeptide;collagen, type XVI, alpha 1;FP1572
Extra Details:: This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion.