A1872
TRIM5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1872
- Additional Names:
- RNF88|TRIM5|TRIM5alpha
- Application:
- ELISA, WB
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL
- Uniprot:
- Q9C035
- Synonyms:
- ring finger protein 88;RING-type E3 ubiquitin transferase TRIM5;RNF88;TRIM5alpha;tripartite motif containing 5 transcript variant iota;tripartite motif containing 5 transcript variant kappa;tripartite motif protein TRIM5;tripartite motif-containing protein 5
- Extra Details:
- The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coilel-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiqutinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice

