Pituitary homeobox 2 (PITX2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A1870
Additional Names:: ARP1|ASGD4|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|Otlx2|Pituitary homeobox 2 (PITX2)|PTX2|RGS|RIEG|RIEG1|RS
Application:: ELISA, WB
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFT
Uniprot:: Q99697
Synonyms:: all1-responsive gene 1;ALL1-responsive protein ARP1;ARP1;ASGD4;Brx1;homeobox protein PITX2;IDG2;IGDS;IGDS2;IHG2;IRID2;Otlx2;paired-like homeodomain transcription factor 2;pituitary homeobox 2;PTX2;RGS;RIEG;RIEG bicoid-related homeobox transcription factor;rieg bicoid-related homeobox transcription factor 1;RIEG1;RS;solurshin
Extra Details:: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Shipping Conditions:: Blue Ice