A18687
ATF4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18687
- Additional Names:
- ATF4|CREB-2|CREB2|TAXREB67|TXREB
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
- Uniprot:
- P18848
- Synonyms:
- Activating transcription factor 4;cAMP response element-binding protein 2;cAMP-dependent transcription factor ATF-4;cAMP-responsive element-binding protein 2;CREB-2;CREB2;cyclic AMP-dependent transcription factor ATF-4;cyclic AMP-responsive element-binding protein 2;DNA-binding protein TAXREB67;tax-responsive enhancer element B67;tax-responsive enhancer element-binding protein 67;TAXREB67;TXREB
- Extra Details:
- This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromosome at q28 in a region containing a large inverted duplication.
- Shipping Conditions:
- Blue Ice







