A18681
TAB3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18681
- Additional Names:
- MAP3K7IP3|NAP1|TAB3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 100kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- QPSPRNQHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
- Uniprot:
- Q8N5C8
- Synonyms:
- MAP3K7IP3;mitogen-activated protein kinase kinase kinase 7 interacting protein 3;Mitogen-activated protein kinase kinase kinase 7-interacting protein 3;NAP1;NF-kappa-B-activating protein 1;NFkB activating protein 1;TAB-3;TAK1-binding protein 3;TGF-beta activated kinase 1 and MAP3K7 binding protein 3;TGF-beta-activated kinase 1 and MAP3K7-binding protein 3;TGF-beta-activated kinase 1-binding protein 3
- Extra Details:
- The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
- Shipping Conditions:
- Blue Ice