A18670
PIGO Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18670
- Additional Names:
- HPMRS2|PIGO
- Application:
- ELISA, WB
- Molecular Weight:
- 119kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- FAVGCPLLLLWPFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFILGIQILACALAASILRRHLMVWKVFAPKFIF
- Uniprot:
- Q8TEQ8
- Synonyms:
- GPI ethanolamine phosphate transferase 3;HPMRS2;phosphatidylinositol-glycan biosynthesis class O protein
- Extra Details:
- This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least three alternatively spliced transcripts encoding two distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice