KLF11 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18659
Additional Names:: FKLF|FKLF1|KLF11|MODY7|TIEG2|Tieg3
Application:: ELISA, WB
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT
Uniprot:: O14901
Synonyms:: FKLF;FKLF1;Krueppel-like factor 11;MODY7;TGFB-inducible early growth response protein 2;TIEG-2;TIEG2;Tieg3;transforming growth factor-beta-inducible early growth response protein 2
Extra Details:: The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene.