A18644
CENPF Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18644
- Additional Names:
- CENF|CENPF|CILD31|hcp-1|PRO1779|STROMS
- Application:
- ELISA, WB
- Molecular Weight:
- 330kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- NYEPPGEDKTQGSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRVETSEGLNSDLEMHADKSSREDIGDNVAKVN
- Uniprot:
- P49454
- Synonyms:
- AH antigen;cell-cycle-dependent 350K nuclear protein;CENF;CENP-F kinetochore protein;centromere protein F;centromere protein F, 350/400kDa;CILD31;hcp-1;kinetochore protein CENPF;mitosin;PRO1779;STROMS
- Extra Details:
- This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease.
- Shipping Conditions:
- Blue Ice