[KO Validated] Bax Rabbit monoclonal antibody

Size

POA

SKU:: A18642
Additional Names:: ax|BCL2L4
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 21kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
Uniprot:: Q07812
Synonyms:: apoptosis regulator BAX;Baxdelta2G9;Baxdelta2G9omega;Baxdelta2omega;bcl-2-like protein 4;BCL2 associated X protein;BCL2-associated X protein omega;bcl2-L-4;BCL2L4
Extra Details:: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Shipping Conditions:: Blue Ice