A18636
KDM2A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18636
- Additional Names:
- CXXC8|FBL11|FBL7|FBXL11|JHDM1A|KDM2A|LILINA
- Application:
- ELISA, WB
- Molecular Weight:
- 126kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKM
- Uniprot:
- Q9Y2K7
- Synonyms:
- [Histone-H3]-lysine-36 demethylase 1A;CXXC-type zinc finger protein 8;CXXC8;F-box and leucine-rich repeat protein 11;F-box protein FBL7;F-box protein Lilina;F-box/LRR-repeat protein 11;FBL11;FBL7;FBXL11;JHDM1A;jmjC domain-containing histone demethylation protein 1A;jumonji C domain-containing histone demethylase 1A;LILINA;lysine (K)-specific demethylase 2A;lysine-specific demethylase 2A
- Extra Details:
- This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least six highly degenerated leucine-rich repeats. This family member plays a role in epigenetic silencing. It nucleates at CpG islands and specifically demethylates both mono- and di-methylated lysine-36 of histone H3. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

