A18630
DGCR8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18630
- Additional Names:
- C22orf12|DGCR8|DGCRK6|Gy1|pasha
- Application:
- ELISA, WB, IHC-P, IP
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSI
- Uniprot:
- Q8WYQ5
- Synonyms:
- C22orf12;DGCRK6;DiGeorge syndrome critical region 8;DiGeorge syndrome critical region gene 8;Gy1;microprocessor complex subunit DGCR8;pasha
- Extra Details:
- This gene encodes a subunit of the microprocessor complex which mediates the biogenesis of microRNAs from the primary microRNA transcript. The encoded protein is a double-stranded RNA binding protein that functions as the non-catalytic subunit of the microprocessor complex. This protein is required for binding the double-stranded RNA substrate and facilitates cleavage of the RNA by the ribonuclease III protein, Drosha. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice








