A18607
KLF14 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18607
- Additional Names:
- BTEB5|KLF14
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- PGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
- Uniprot:
- Q8TD94
- Synonyms:
- basic transcription element-binding protein 5;BTE-binding protein 5;BTEB5;Krueppel-like factor 14;transcription factor BTEB5
- Extra Details:
- This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression. This gene exhibits imprinted expression from the maternal allele in embryonic and extra-embryonic tissues.
- Shipping Conditions:
- Blue Ice



