A18597
Histone H1t Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18597
- Additional Names:
- H1-6|H1.6|H1ft|H1t|Hist1h1t|Histone H1t
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- LSKKAASGNDKGKGKKSASAKAKKMGLPRASRSPKSSKTKAVKKPKATPTKASGSGRKTKGAKGVQQRKSPAKARAANPNSGKAKMVMQKTDLRKAAGRK
- Uniprot:
- Q07133
- Synonyms:
- H1 histone family, member T (testis-specific);H1-6;H1.6;H1ft;H1t;Hist1h;Hist1h1t;histone 1, H1t;histone cluster 1, H1t;histone H1t;testicular H1 histone
- Extra Details:
- Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element
- Shipping Conditions:
- Blue Ice







