IFNAR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18594
Additional Names:: AVP|IFN-alpha-REC|IFNAR|IFNAR1|IFNBR|IFRC|IMD106
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Uniprot:: P17181
Synonyms:: alpha-type antiviral protein;AVP;beta-type antiviral protein;CRF2-1;cytokine receptor class-II member 1;cytokine receptor family 2 member 1;IFN-alpha-REC;IFN-alpha/beta receptor 1;IFN-R-1;IFNalpha/beta receptor 1;IFNAR;IFNBR;IFRC;interferon (alpha, beta and omega) receptor 1;interferon alpha/beta receptor 1;interferon receptor 1;interferon-alpha/beta receptor alpha chain;interferon-beta receptor 1;type I interferon receptor 1
Extra Details:: The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family and functions as an antiviral factor.