POU3F2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18576
Additional Names:: brn-2|BRN2|N-Oct3|oct-7|OCT7|OTF-7|OTF7|POU3F2|POUF3
Application:: ELISA, WB
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHG
Uniprot:: P20265
Synonyms:: brain-2;brain-specific homeobox/POU domain protein 2;brn-2;BRN2;N-Oct3;nervous system-specific octamer-binding transcription factor N-Oct-3;oct-7;OCT7;octamer-binding protein 7;octamer-binding transcription factor 7;OTF-7;OTF7;POU domain, class 3, transcription factor 2;POUF3
Extra Details:: This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.