ZNF645 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18553
Additional Names:: CT138|HAKAIL|ZNF645
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY
Uniprot:: Q8N7E2
Synonyms:: c-Cbl-like protein 2;cbl proto-oncogene-like protein 2;CT138;E3 ubiquitin ligase;E3 ubiquitin-protein ligase CBLL2;E3 ubiquitin-protein ligase ZNF645;HAKAIL;RING-type E3 ubiquitin transferase ZNF645;zinc finger protein 645;ZNF645
Extra Details:: This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control.