TMEM18 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18541
Additional Names:: lncND|TMEM18
Application:: ELISA, WB
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP
Uniprot:: Q96B42
Synonyms:: lncND;transmembrane protein 18
Extra Details:: Predicted to enable DNA binding activity. Involved in cell migration. Located in nuclear membrane.