A18526
Topors Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18526
- Additional Names:
- LUN|p53BP3/LUN|Topors|TP53BPL
- Application:
- ELISA, WB
- Molecular Weight:
- 119kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
- Uniprot:
- Q80Z37
- Synonyms:
- AW105885;E3 ubiquitin-protein ligase Topors;LUN;p53-binding protein 3;p53BP3;p53BP3/LUN;RING-type E3 ubiquitin transferase Topors;SUMO1-protein E3 ligase Topors;topoisomerase 1-binding RING finger;topoisomerase I-binding arginine/serine-rich protein;topoisomerase I-binding RING finger protein;TP53BPL;tumor suppressor p53-binding protein 3
- Extra Details:
- Predicted to enable several functions, including DNA topoisomerase binding activity; antigen binding activity; and ubiquitin-like protein transferase activity. Acts upstream of or within intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator; positive regulation of transcription, DNA-templated; and regulation of cell population proliferation. Located in ciliary basal body; nucleus; and photoreceptor connecting cilium. Is expressed in skin. Human ortholog(s) of this gene implicated in retinitis pigmentosa 31. Orthologous to human TOPORS (TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase).
- Shipping Conditions:
- Blue Ice