A18499
ABTB1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18499
- Additional Names:
- ABTB1|BPOZ|BTB3|BTBD21|EF1ABP|PP2259
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPLYYACLCGHEELVLYLLANGARCEANTFDGERCLYGALSDPIRRALRDYKQVTASCRRRDYYDDFLQRLLEQGIHSDVVFVVHGKPFRVHRCVLGARSAYF
- Uniprot:
- Q969K4
- Synonyms:
- ankyrin repeat and BTB (POZ) domain containing 1;ankyrin repeat and BTB/POZ domain-containing protein 1;BPOZ;BTB3;BTBD21;EF1ABP;elongation factor 1A-binding protein;PP2259
- Extra Details:
- This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants.
- Shipping Conditions:
- Blue Ice

