SERINC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18478
Additional Names:: SERINC1|TDE1L|TDE2|TMS-2|TMS2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 50kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: ESTLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQWTAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD
Uniprot:: Q9NRX5
Synonyms:: serine incorporator 1;TDE1L;TDE2;TMS-2;TMS2;Tumor differentially expressed protein 1-like;tumor differentially expressed protein 2
Extra Details:: Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in several processes, including phosphatidylserine metabolic process; positive regulation of CDP-diacylglycerol-serine O-phosphatidyltransferase activity; and positive regulation of serine C-palmitoyltransferase activity. Predicted to be located in endoplasmic reticulum membrane and plasma membrane. Predicted to be active in membrane.