A18475
ZNF302 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18475
- Additional Names:
- HSD16|MST154|MSTP154|ZNF135L|ZNF140L|ZNF302|ZNF327
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- DEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKI
- Uniprot:
- Q9NR11
- Synonyms:
- HSD16;MST154;MSTP154;Zinc finger protein 135-like;Zinc finger protein 140-like;zinc finger protein 302;zinc finger protein 327;ZNF135L;ZNF140L;ZNF327
- Extra Details:
- This gene encodes a member of the zinc-finger protein family. The encoded protein contains seven C2H2-type zinc fingers and a KRAB domain, but its function has yet to be determined. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice