A18455
UTP11L Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18455
- Additional Names:
- CGI-94|CGI94|UTP11L
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- VAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVKGVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN
- Uniprot:
- Q9Y3A2
- Synonyms:
- CGI-94;CGI94;probable U3 small nucleolar RNA-associated protein 11;U3 snoRNA-associated protein 11;UTP11-like protein;UTP11-like, U3 small nucleolar ribonucleoprotein;UTP11, small subunit processome component homolog;UTP11L
- Extra Details:
- Enables RNA binding activity. Involved in nervous system development and positive regulation of apoptotic process. Located in cytoplasm; extracellular space; and nucleolus.
- Shipping Conditions:
- Blue Ice