REPIN1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18451
Additional Names:: AP4|REPIN1|RIP60|Zfp464|ZNF464
Application:: ELISA, WB
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV
Uniprot:: Q9BWE0
Synonyms:: 60 kDa origin-specific DNA-binding protein;60 kDa replication initiation region protein;AP4;ATT-binding protein;DHFR oribeta-binding protein RIP60;H_DJ0584D14.12;replication initiation region protein (60kD);replication initiator 1;RIP60;Zfp464;Zinc finger protein 464;zinc finger protein 464 (RIP60);zinc finger protein AP4;ZNF464
Extra Details:: Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of glucose import and regulation of fatty acid transport. Located in nucleoplasm.