RHOBTB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18432
Additional Names:: DBC2|DEE64|EIEE64|p83|RHOBTB2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 83kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVF
Uniprot:: Q9BYZ6
Synonyms:: DBC2;DEE64;deleted in breast cancer 2 gene protein;EIEE64;p83;rho-related BTB domain-containing protein 2
Extra Details:: The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene.