A18427
NUP205 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18427
- Additional Names:
- C7orf14|NPHS13|NUP205
- Application:
- ELISA, WB
- Molecular Weight:
- 250kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- AASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
- Uniprot:
- Q92621
- Synonyms:
- 205 kDa nucleoporin;C7orf14;NPHS13;nuclear pore complex protein Nup205;nucleoporin Nup205
- Extra Details:
- This gene encodes a nucleoporin, which is a subunit of the nuclear pore complex that functions in active transport of proteins, RNAs and ribonucleoprotein particles between the nucleus and cytoplasm. Mutations in this gene are associated with steroid-resistant nephrotic syndrome.
- Shipping Conditions:
- Blue Ice

