A18402
SMC3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18402
- Additional Names:
- BAM|BMH|CDLS3|CSPG6|HCAP|SMC3|SMC3L1
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 142kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- KEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHID
- Uniprot:
- Q9UQE7
- Synonyms:
- BAM;basement membrane-associated chondroitin proteoglycan;BMH;CDLS3;Chondroitin sulfate proteoglycan 6;chondroitin sulfate proteoglycan 6 (bamacan);chromosome-associated polypeptide;CSPG6;HCAP;SMC protein 3;SMC3L1;structural maintenance of chromosomes protein 3
- Extra Details:
- This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
- Shipping Conditions:
- Blue Ice