OX40L Rabbit polyclonal antibody

Size

£152.00

SKU:: A18389
Additional Names:: CD134L|CD252|GP34|OX-40L|OX40L|OX4OL|TNLG2B|TXGP1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 30kDa/21kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Uniprot:: P23510
Synonyms:: CD134 ligand;CD134L;CD252;glycoprotein Gp34;GP34;OX-40L;OX40 antigen ligand;OX40 ligand;OX4OL;TAX transcriptionally-activated glycoprotein 1;tax-transcriptionally activated glycoprotein 1 (34kD);TNLG2B;tumor necrosis factor (ligand) superfamily member 4;tumor necrosis factor ligand 2B;tumor necrosis factor ligand superfamily member 4;tumor necrosis factor superfamily member 4;TXGP1
Extra Details:: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.