A18342
FFAR4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18342
- Additional Names:
- BMIQ10|FFAR4|GPR120|GPR129|GT01|O3FAR1|OB10Q|PGR4
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPT
- Uniprot:
- Q5NUL3
- Synonyms:
- BMIQ10;free fatty acid receptor 4;G-protein coupled receptor 120;G-protein coupled receptor 129;G-protein coupled receptor GT01;G-protein coupled receptor PGR4;GPR120;GPR129;GT01;O3FAR1;omega-3 fatty acid receptor 1;PGR4
- Extra Details:
- This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

