A18338
ARHGAP4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18338
- Additional Names:
- ARHGAP4|C1|p115|RGC1|RhoGAP4|SrGAP4
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- SPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH
- Uniprot:
- P98171
- Synonyms:
- C1;p115;RGC1;rho GTPase-activating protein 4;Rho-GAP hematopoietic protein C1;rho-type GTPase-activating protein 4;RhoGAP4;SrGAP4
- Extra Details:
- This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








