A18321
PEX11B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18321
- Additional Names:
- PEX11-BETA|PEX11B|PEX11beta|PEX14B
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- DNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG
- Uniprot:
- O96011
- Synonyms:
- peroxin-11B;peroxisomal biogenesis factor 11B;peroxisomal membrane protein 11B;PEX11-BETA;PEX14B;protein PEX11 homolog beta
- Extra Details:
- The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
- Shipping Conditions:
- Blue Ice

