A18270
BCAR1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18270
- Additional Names:
- BCAR1|CAS|CAS1|CASS1|CRKAS|P130Cas
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- EPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATA
- Uniprot:
- P56945
- Synonyms:
- BCAR1, Cas family scaffold protein;BCAR1, Cas family scaffolding protein;breast cancer anti-estrogen resistance protein 1;CAS;Cas scaffolding protein family member 1;CAS1;CASS1;CRK-associated substrate;Crk-associated substrate p130Cas;CRKAS;P130Cas
- Extra Details:
- The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded protein contains a Src-homology 3 (SH3) domain, a proline-rich domain, a substrate domain which contains 15 repeat of the YxxP consensus phosphorylation motif for Src family kinases, a serine-rich domain, and a bipartite Src-binding domain, which can bind both SH2 and SH3 domains. This adaptor protein functions in multiple cellular pathways, including in cell motility, apoptosis and cell cycle control. Dysregulation of this gene can have a wide range of effects, affecting different pathways, including cardiac development, vascular smooth muscle cells, liver and kidney function, endothelial migration, and cancer.
- Shipping Conditions:
- Blue Ice