A18263
PSMD6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18263
- Additional Names:
- p42A|p44S10|PSMD6|Rpn7|S10|SGA-113M
- Application:
- ELISA, WB
- Molecular Weight:
- 46kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- RFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQL
- Uniprot:
- Q15008
- Synonyms:
- 26S proteasome non-ATPase regulatory subunit 6;26S proteasome regulatory subunit RPN7;26S proteasome regulatory subunit S10;breast cancer-associated protein SGA-113M;p42A;p44S10;phosphonoformate immuno-associated protein 4;proteasome (prosome, macropain) 26S subunit, non-ATPase, 6;proteasome regulatory particle subunit p44S10;Rpn7;S10;SGA-113M
- Extra Details:
- This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants
- Shipping Conditions:
- Blue Ice



