A18250
NOP10 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18250
- Additional Names:
- DKCB1|NOLA3|NOP10|NOP10P
- Application:
- ELISA, WB
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
- Uniprot:
- Q9NPE3
- Synonyms:
- DKCB1;H/ACA ribonucleoprotein complex subunit 3;homolog of yeast Nop10p;NOLA3;NOP10 ribonucleoprotein homolog;NOP10P;nucleolar protein 10;nucleolar protein family A member 3;nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs);snoRNP protein NOP10
- Extra Details:
- This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p.
- Shipping Conditions:
- Blue Ice

