Mrpl55 Rabbit polyclonal antibody

Size

POA

SKU:: A18244
Additional Names:: 2810038N09Rik|L55mt|MRP-L55|Mrpl55
Application:: ELISA, WB
Molecular Weight:: 13-14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK
Uniprot:: Q9CZ83
Synonyms:: 2810038N09Rik;39S ribosomal protein L55, mitochondrial;AAVG5835;L55mt;L55nt;mitochondrial large ribosomal subunit protein bL31m;mitochondrial large ribosomal subunit protein mL55;MRP-L55;PRO19675
Extra Details:: Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus; gonad; heart; liver; and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).