A18242
MRPL55 Rabbit polyclonal antibody
Size
POA
- SKU:
- A18242
- Additional Names:
- AAVG5835|L55nt|MRP-L55|MRPL55|PRO19675
- Application:
- ELISA, WB
- Molecular Weight:
- 15kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK
- Uniprot:
- Q7Z7F7
- Synonyms:
- 39S ribosomal protein L55, mitochondrial;AAVG5835;L55mt;L55nt;mitochondrial large ribosomal subunit protein bL31m;mitochondrial large ribosomal subunit protein mL55;MRP-L55;PRO19675
- Extra Details:
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis.
- Shipping Conditions:
- Blue Ice