HSPB11 Rabbit polyclonal antibody

Size

POA

SKU:: A18224
Additional Names:: C1orf41|CFAP232|FAP232|HSPB11|HSPCO34|PP25
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 16kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
Uniprot:: Q9Y547
Synonyms:: C1orf41;FAP232;heat shock protein beta-11;heat shock protein family B (small), member 11;HSPCO34;IFT25;intraflagellar transport 25 homolog;intraflagellar transport protein 25 homolog;placental protein 25;PP25
Extra Details:: Predicted to enable metal ion binding activity. Predicted to be involved in kidney development and spermatogenesis. Predicted to act upstream of or within animal organ development; left/right axis specification; and skeletal system development. Predicted to be located in ciliary tip. Predicted to be part of intraciliary transport particle B. Predicted to be active in centrosome and cilium.