A18186
Mrpl18 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18186
- Additional Names:
- 1010001C05Rik|HSPC071|MRP-L18|Mrpl18
- Application:
- ELISA, WB
- Molecular Weight:
- 18kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE
- Uniprot:
- Q9CQL5
- Synonyms:
- 1010001C05Rik;39S ribosomal protein L18, mitochondrial;C79879;HSPC0;HSPC071;L18mt;mitochondrial large ribosomal subunit protein uL18m;MRP-;MRP-L18
- Extra Details:
- Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain; connective tissue; early conceptus; genitourinary system; and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18).
- Shipping Conditions:
- Blue Ice