PIN4 Rabbit polyclonal antibody

Size

POA

SKU:: A18173
Additional Names:: EPVH|hEPVH|hPar14|hPar17|PAR14|PAR17|PIN4
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Uniprot:: Q9Y237
Synonyms:: EPVH;eukaryotic parvulin homolog;hEPVH;hPar14;hPar17;PAR14;PAR17;parvulin;parvulin-14;parvulin-17;peptidyl-prolyl cis-trans isomerase NIMA-interacting 4;peptidyl-prolyl cis-trans isomerase Pin4;peptidyl-prolyl cis/trans isomerase EPVH;PPIase PIN4;protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin);rotamase PIN4
Extra Details:: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria.