CYSLTR1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1815
Additional Names:: CYSLT1|CYSLT1R|CYSLTR|CYSLTR1|HMTMF81
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLST
Uniprot:: Q9Y271
Synonyms:: CYSLT1;CYSLT1R;CYSLTR;cysteinyl leukotriene D4 receptor;cysteinyl leukotriene receptor 1;G-protein coupled receptor HG55;HMTMF81;LTD4 receptor
Extra Details:: This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants.