A1815
CYSLTR1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1815
- Additional Names:
- CYSLT1|CYSLT1R|CYSLTR|CYSLTR1|HMTMF81
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLST
- Uniprot:
- Q9Y271
- Synonyms:
- CYSLT1;CYSLT1R;CYSLTR;cysteinyl leukotriene D4 receptor;cysteinyl leukotriene receptor 1;G-protein coupled receptor HG55;HMTMF81;LTD4 receptor
- Extra Details:
- This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

