ANGPTL8 Rabbit polyclonal antibody

Size

POA

SKU:: A18133
Additional Names:: ANGPTL8|C19orf80|PRO1185|PVPA599|RIFL|TD26
Application:: ELISA, WB
Molecular Weight:: 24 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Uniprot:: Q6UXH0
Synonyms:: angiopoietin-like protein 8;Betatrophin;betatrophin variant 1;betatrophin variant 2;C19orf80;hepatocellular carcinoma-associated gene TD26;hepatocellular carcinoma-associated protein TD26;lipasin;PRO1185;PVPA599;refeeding-induced fat and liver protein;RIFL;TD26
Extra Details:: Predicted to enable hormone activity. Involved in regulation of lipid metabolic process and triglyceride homeostasis. Acts upstream of or within positive regulation of protein processing and regulation of lipoprotein metabolic process. Located in extracellular region.