A18120
Pan-Akt Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A18120
- Additional Names:
- AKT1/AKT2/AKT3|Pan-Akt
- Application:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
- Uniprot:
- P31749, P31751, Q9Y243
- Synonyms:
- AKT;AKT1m;HIHGHH;MPPH;MPPH2;murine thymoma viral (v-akt) homolog-2;PKB;PKB alpha;PKB beta;PKB gamma;PKB-ALPHA;PKB-GAMMA;PKBB;PKBBETA;PKBG;PRKBA;PRKBB;PRKBG;protein kinase Akt-2;Protein kinase Akt-3;Protein kinase B;protein kinase B alpha;protein kinase B beta;Protein kinase B gamma;proto-oncogene c-Akt;putative v-akt murine thymoma viral oncoprotein 2;RAC;rac protein kinase alpha;rac protein kinase beta;RAC-ALPHA;RAC-alpha serine/threonine-protein kinase;RAC-BETA;RAC-beta serine/threonine-protein kinase;RAC-gamma;RAC-gamma serine/threonine protein kinase;RAC-gamma serine/threonine-protein kinase;RAC-PK-alpha;RAC-PK-beta;RAC-PK-gamma;serine-threonine protein kinase;STK-2;v-akt murine thymoma viral oncogene homolog 1;v-akt murine thymoma viral oncogene homolog 2;v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma);v-akt murine thymoma viral oncogene-like protein 1
- Extra Details:
- Human AKT serine-threonine protein kinase family includes three members AKT1,AKT2, AKT3, which are also often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain, a serine/threonine-specific kinase domain and a C-terminal regulatory domain. These proteins are phosphorylated by phosphoinositide 3-kinase (PI3K). AKT/PI3K forms a key component of many signalling pathways that involve the binding of membrane-bound ligands such as receptor tyrosine kinases, G-protein coupled receptors, and integrin-linked kinase. These AKT proteins therefore regulate a wide variety of cellular functions including cell proliferation, survival, metabolism, and angiogenesis in both normal and malignant cells. AKT proteins are recruited to the cell membrane by phosphatidylinositol 3,4,5-trisphosphate (PIP3) after phosphorylation of phosphatidylinositol 4,5-bisphosphate (PIP2) by PI3K. Subsequent phosphorylation of both threonine residue 308 and serine residue 473 is required for full activation of the AKT1 protein encoded by this gene.
- Shipping Conditions:
- Blue Ice