TEX101 Rabbit polyclonal antibody

Size

POA

SKU:: A18118
Additional Names:: CT131|GTPR867|NYD-SP8|PRO1884|SGRG|SPATA44|TES101RP|TEX101
Application:: ELISA, WB, IHC-P
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS
Uniprot:: Q9BY14
Synonyms:: cancer/testis antigen 131;cell surface receptor NYD-SP8;CT131;GTPR867;NYD-SP8;PRO1884;scleroderma-associated autoantigen;SGRG;SPATA44;spermatogenesis associated 44;spermatogenesis-related gene protein;TES101-reactive protein;TES101RP;testis expressed sequence 101;testis-expressed protein 101;testis-expressed sequence 101 protein;testis-specific protein TES101RP
Extra Details:: Predicted to be involved in binding activity of sperm to zona pellucida; flagellated sperm motility; and regulation of flagellated sperm motility. Predicted to be located in acrosomal vesicle; extracellular region; and plasma membrane. Predicted to be active in plasma membrane raft. Predicted to be anchored component of plasma membrane.