A18115
ALG13 Rabbit polyclonal antibody

Size
POA
- SKU:
- A18115
- Additional Names:
- ALG13|CDG1S|CXorf45|DEE36|EIEE36|GLT28D1|MDS031|TDRD13|YGL047W
- Application:
- ELISA, WB
- Molecular Weight:
- 126kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
- Uniprot:
- Q9NP73
- Synonyms:
- asparagine-linked glycosylation 13 homolog;CDG1S;CXorf45;DEE36;EIEE36;GLT28D1;glycosyltransferase 28 domain-containing protein 1;hematopoietic stem/progenitor cells protein MDS031;MDS031;N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase;putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13;TDRD13;tudor domain containing 13;UDP-N-acetylglucosamine transferase subunit ALG13 homolog;YGL047W
- Extra Details:
- The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice

