A18111
MCHR1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A18111
- Additional Names:
- GPR24|MCH-1R|MCH1R|MCHR1|SLC-1|SLC1
- Application:
- ELISA, WB
- Molecular Weight:
- 46kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTS
- Uniprot:
- Q99705
- Synonyms:
- G protein-coupled receptor 24;G-protein coupled receptor 24;GPR24;MCH receptor 1;MCH-1R;MCH1R;melanin-concentrating hormone receptor 1;SLC-1;SLC1;somatostatin receptor-like protein
- Extra Details:
- The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin.
- Shipping Conditions:
- Blue Ice

