SDC2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1810
Additional Names:: CD362|HSPG|HSPG1|SDC2|SYND2
Application:: ELISA, WB, IHC-P
Molecular Weight:: 50kDa/22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
Uniprot:: P34741
Synonyms:: CD362;cell surface-associated heparan sulfate proteoglycan 1;fibroglycan;heparan sulfate proteoglycan 1, cell surface-associated;heparan sulfate proteoglycan core protein;HSPG;HSPG1;SYND2;syndecan proteoglycan 2;syndecan-2
Extra Details:: The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types.