A18081
[KD Validated] DIAPH1 Rabbit polyclonal antibody

Size
POA
- SKU:
- A18081
- Additional Names:
- [KD Validated] DIAPH1|DFNA1|DIA1|DRF1|hDIA1|LFHL1|mDia1|SCBMS
- Application:
- ELISA, WB
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
- Uniprot:
- O60610
- Synonyms:
- DFNA1;DIA1;Diaphanous-related formin-1;DRF1;hDIA1;LFHL1;protein diaphanous homolog 1;SCBMS
- Extra Details:
- This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice
![[KD Validated] DIAPH1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A18081/A18081_1.jpg)
![[KD Validated] DIAPH1 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A18081/A18081_N17470-4_KO-WB_01.jpg)