A18080
[KO Validated] CDK5 Rabbit polyclonal antibody

Size
POA
- SKU:
- A18080
- Additional Names:
- K5|LIS7|PSSALRE
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
- Uniprot:
- Q00535
- Synonyms:
- cell division protein kinase 5;cyclin-dependent-like kinase 5;epididymis secretory sperm binding protein;LIS7;protein kinase CDK5 splicing;PSSALRE;serine/threonine-protein kinase PSSALRE;tau protein kinase II catalytic subunit;TPKII catalytic subunit
- Extra Details:
- This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice
![[KO Validated] CDK5 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A18080/A18080_1.jpg)
![[KO Validated] CDK5 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A18080/A18080_N5119_KO-WB_01.jpg)