AKT2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A18019
Additional Names:: AKT2|HIHGHH|PKBB|PKBBETA|PRKBB|RAC-BETA
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
Uniprot:: P31751
Synonyms:: HIHGHH;murine thymoma viral (v-akt) homolog-2;PKB beta;PKBB;PKBBETA;PRKBB;protein kinase Akt-2;protein kinase B beta;putative v-akt murine thymoma viral oncoprotein 2;rac protein kinase beta;RAC-BETA;RAC-beta serine/threonine-protein kinase;RAC-PK-beta;v-akt murine thymoma viral oncogene homolog 2
Extra Details:: This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains, which is involved in signaling pathways. The gene serves as an oncogene in the tumorigenesis of cancer cells For example, its overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins, and has also been implicated in insulin signaling.