A1800
XRCC2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1800
- Additional Names:
- FANCU|POF17|SPGF50|XRCC2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 32 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT
- Uniprot:
- O43543
- Synonyms:
- DNA repair protein XRCC2;epididymis secretory sperm binding protein;FANCU;POF17;SPGF50;X-ray repair complementing defective repair in Chinese hamster cells 2;X-ray repair cross-complementing protein 2
- Extra Details:
- This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
- Shipping Conditions:
- Blue Ice





