OVOL2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17973
Additional Names:: CHED|CHED1|CHED2|EUROIMAGE566589|OVOL2|PPCD1|ZNF339
Application:: ELISA, WB
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ
Uniprot:: Q9BRP0
Synonyms:: CHED;CHED1;CHED2;corneal endothelial dystrophy 1 (autosomal dominant);EUROIMAGE566589;PPCD1;transcription factor Ovo-like 2;zinc finger protein 339;ZNF339
Extra Details:: This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy.